mRNA-Cyno CD8A

Catalog No.	Gene	Scale	State
LS-RMAbt-177	mRNA-Cyno CD8A	1mg	Lyophilized/Liquid

Catalog No. Gene Scale State

LS-RMAbt-177 mRNA-Cyno CD8A 1mg Lyophilized/Liquid
Product Overview

An off-the-shelf in vitro transcribed (IVT) messenger RNA encoding the Cynomolgus monkey CD8 alpha chain (CD8A), a co-receptor that enhances T cell receptor (TCR) signaling by stabilizing MHC-peptide binding. This synthetic mRNA enables controlled expression of CD8A for research in T cell activation, cytotoxic T lymphocyte (CTL) function, and as a component in bispecific antibody or CAR-T constructs to improve target cell killing efficiency.

Product Details

Storage Buffer: ddH₂O ph=7.0

mRNA length: 1005 nt

Amino acid sequence size: 235 aa

Handling and Storage: store at – 80℃ for long term
Amino acid sequence

MAPPVTALLLPLVLLLHAARPNQFRVSPLGRTWNLGETVELKCQVLLSNPTSGCSWLFQPRGTAARPTFLLYLSQNKPKAAEGLDTQRFSGKRLGDTFVLTLRDFRQENEGYYFCSALSNSIMYFSRFVPVFLPAKPTTTPAPRPPTPAPTTASQPLSLRPEACRPAAGGSVNTRGLDFACDIYIWAPLAGACGVLLLSLVITLYCNHRNRRRVCKCPRPVVKSGGKPSLSDRYV*
Storage & Logistic

Storage Conditions: 2°C to 8°C, protect from light

Shipping Conditions: Ambient

Expiration Date of Liquid Product: 12 Months

Retest Date of Powder Product: 18 Months