- Description
- Product Overview
- Sequence
- Data Chart
- Storage & Logistic
- Documents
-
Catalog No. Gene Scale State LS-RMAbt-178 mRNA-Cyno CD8 (αβ) 1mg Lyophilized/Liquid -
Product Overview
An off-the-shelf in vitro transcribed (IVT) messenger RNA encoding the Cynomolgus monkey CD8 alpha-beta heterodimer (CD8αβ), the canonical co-receptor expressed on cytotoxic T cells. This synthetic mRNA allows for transient expression of the full CD8 co receptor complex, supporting studies on T cell development, thymic selection, and the enhancement of TCR signaling in engineered T cell therapies such as CAR-T or TCR-T.
Product Details
Storage Buffer: ddH2O ph=7.0
mRNA length: 1695 nt
Amino acid sequence size: 465 aa
Handling and Storage: store at – 80℃ for long term
-
Amino acid sequence
MAPPVTALLLPLVLLLHAARPNQFRVSPLGRTWNLGETVELKCQVLLSNPTSGCSWLFQPRGTAARPTFLLYLSQNKPKAAEGLDTQRFSGKRLGDTFVLTLRDFRQENEGYYFCSALSNSIMYFSRFVPVFLPAKPTTTPAPRPPTPAPTTASQPLSLRPEACRPAAGGSVNTRGLDFACDIYIWAPLAGACGVLLLSLVITLYCNHRNRRRVCKCPRPVVKSGGKPSLSDRYVGATNFSLLKQAGDVEENPGPMRPRLWLLLAAQLAVVRGSSVLQQTPAYIQVQTNKMAMLSCEAKISLGNMRIYWLRQRQAPSSDSHHEFLALWDSTKGTVHGEEVAQEKIAVFRDASRFILNLTSVKPEDSGIYFCMIIGSPELTFGKGTQLSVVDFLPTTAQPTKKSTPKKRGCRLPRPATQKGPLCSPITLGLLVAGVLVLLVSLGVAIHLYCRRRRAR LRFIKQFYK*
-
Storage & Logistic
Storage Conditions: 2°C to 8°C, protect from light
Shipping Conditions: Ambient
Expiration Date of Liquid Product: 12 Months
Retest Date of Powder Product: 18 Months
Get in Touch with Levostar
Please send us your request or email to support@levostar.com, our team will contact you as soon as possible.