Products

Products

mRNA-Cyno CD8(αβ)

Catalog No. Gene Scale State
LS-RMAbt-178 mRNA-Cyno CD8 (αβ) 1mg Lyophilized/Liquid
  • Description
  • Product Overview
  • Sequence
  • Data Chart
  • Storage & Logistic
  • Documents
  • Catalog No. Gene Scale State
    LS-RMAbt-178 mRNA-Cyno CD8 (αβ) 1mg Lyophilized/Liquid
  • Product Overview

    An off-the-shelf in vitro transcribed (IVT) messenger RNA encoding the Cynomolgus monkey CD8 alpha-beta heterodimer (CD8αβ), the canonical co-receptor expressed on cytotoxic T cells. This synthetic mRNA allows for transient expression of the full CD8 co receptor complex, supporting studies on T cell development, thymic selection, and the enhancement of TCR signaling in engineered T cell therapies such as CAR-T or TCR-T.

    Product Details

    Storage Buffer: ddH2O ph=7.0

    mRNA length: 1695 nt

    Amino acid sequence size: 465 aa

    Handling and Storage: store at – 80℃ for long term

  • Amino acid sequence

    MAPPVTALLLPLVLLLHAARPNQFRVSPLGRTWNLGETVELKCQVLLSNPTSGCSWLFQPRGTAARPTFLLYLSQNKPKAAEGLDTQRFSGKRLGDTFVLTLRDFRQENEGYYFCSALSNSIMYFSRFVPVFLPAKPTTTPAPRPPTPAPTTASQPLSLRPEACRPAAGGSVNTRGLDFACDIYIWAPLAGACGVLLLSLVITLYCNHRNRRRVCKCPRPVVKSGGKPSLSDRYVGATNFSLLKQAGDVEENPGPMRPRLWLLLAAQLAVVRGSSVLQQTPAYIQVQTNKMAMLSCEAKISLGNMRIYWLRQRQAPSSDSHHEFLALWDSTKGTVHGEEVAQEKIAVFRDASRFILNLTSVKPEDSGIYFCMIIGSPELTFGKGTQLSVVDFLPTTAQPTKKSTPKKRGCRLPRPATQKGPLCSPITLGLLVAGVLVLLVSLGVAIHLYCRRRRAR LRFIKQFYK*

  • Storage & Logistic

    Storage Conditions: 2°C to 8°C, protect from light

    Shipping Conditions: Ambient

    Expiration Date of Liquid Product: 12 Months

    Retest Date of Powder Product: 18 Months

Get in Touch with Levostar

Please send us your request or email to support@levostar.com, our team will contact you as soon as possible.

Submit

Download Application Note

Collecting your relevant information will help Levostar provide you with better service.

图片名称

Get in Touch with Levostar

Please send us your request or email to support@levostar.com, our team will contact you as soon as possible.

Submit
%{tishi_zhanwei}%