mRNA-Cyno CD3(εγδζ)

Cat.#	Gene	Scale	State
LS-RMAbt-175	mRNA-Cyno CD3 (εγδζ)	1mg	Lyophilized/Liquid

Order Now

Contact

Description
Product Overview
Sequence
Data Chart
Storage & Logistic
Documents

Cat.# Gene Scale State

LS-RMAbt-175 mRNA-Cyno CD3 (εγδζ) 1mg Lyophilized/Liquid
Product Overview

An off-the-shelf in vitro transcribed (IVT) messenger RNA encoding the Cynomolgus monkey CD3 epsilon-gamma-delta-zeta (εγδζ) chimeric signaling domain. This synthetic mRNA is designed to control the expression of the full CD3 complex with integrated co-stimulatory signals, enabling rapid functional studies of T cell activation, chimeric antigen receptor (CAR) T cell signaling, and TCR-mediated immune responses without the need for plasmid transfection or protein purification.

Product Details

Storage Buffer: ddH₂O ph=7.0

mRNA length: 2643 nt

Amino acid sequence size: 781 aa

Handling and Storage: store at – 80℃ for long term
Amino acid sequence

MQSGTRWRVLGLCLLSIGVWGQDGNEEMGSITQTPYQVSISGTTVILTCSQHLGSEAQWQHNGKNKEDSGDRLFLPEFSEMEQSGYYVCYPRGSNPEDASHHLYLKARVCENCMEMDVMAVATIVIVDICITLGLLLLVYYWSKNRKAKAKPVTRGAGAGGRQRGQNKERPPPVPNPDYEPIRKGQQDLYSGLNQRRIGSGATNFSLLKQAGDVEENPGPMVQGKGLTGFILAIILLQGSLAQSFEENRKLNVYNQEDGSVLLTCHVKNTNITWFKEGKMIDILTAHKNKWNLGSNTKDPRGVYQCKGSKDKSKTLQVYYRMCQNCIELNAATILGFVFAEIISIFFLAVGVYFIAGQDGVRQSRASDKQTLLPNDQLYQPLKDREDDQYSHLQGNQLRMNGSGATNFSLLKQAGDVEENPGPMEHSTFLSGLVLATLLSQVSPFKIPVEELEDRVFVKCNTSVTWVEGTVGTLLTNNTRLDLGKRILDPRGIYRCNGTDIYKDKESAVQVHYRMCQNCVELDPATLAGIIVTDVIATLLLALGVFCFAGHETGRLSGAADTQALLRNDQVYQPLRDRDDAQYSRLGGNWARNKGSGATNFSLLKQAGDVEENPGPMKWKALFTAAILQAQFPITEAQSFGLLDPKLCYLLDGILFLYGVILTALFLRAKFSRSADAPAYQQGQNQLYNELNLGRREEYDVLDKR RGRDPEMGGKPRRKNPQEGLYNALQKDKMAEAYSEIGMKGENQRRRGKGHDGLYQGLSTATKDTYDALHMQTLPPR*
Storage & Logistic

Storage Conditions: 2°C to 8°C, protect from light

Shipping Conditions: Ambient

Expiration Date of Liquid Product: 12 Months

Retest Date of Powder Product: 18 Months