mRNA-CD8B

Catalog No.	Gene	Scale	State
LS-RMCar-002	mRNA-CD8B	1mg	Lyophilized/Liquid

Catalog No. Gene Scale State
LS-RMCar-002 mRNA-CD8B 1mg Lyophilized/Liquid
Product Overview
mRNA-CD8B (Cluster of Differentiation 8 Beta) is a ready-to-use mRNA product encoding the CD8β molecule. It is suitable for T cell function studies and cytotoxic immunity research. CD8β pairs with CD8α to form the CD8 co-receptor, which plays a critical role in enhancing TCR-mediated signaling and regulating T cell function.
Product Details
Concentration: 1mg/mL
Storage Buffer: ddH₂O ph=7.0
mRNA length: 930 nt
Amino acid sequence size: 210 aa
Handling and Storage: store at – 80℃ for long term
Amino acid sequence
MRPRLWLLLAAQLTVLHGNSVLQQTPAYIKVQTNKMVMLSCEAKISLSNMRIYWLRQRQAPSSDSHHEFLALWDSAKGTIHGEEVEQEKIAVFRDASRFILNLTSVKPEDSGIYFCMIVGSPELTFGKGTQLSVVDFLPTTAQPTKKSTLKKRVCRLPRPETQKGPLCSPITLGLLVAGVLVLLVSLGVAIHLCCRRRRARLRFMKQFYK
Cell Expression result:
Cell Line: A549
Culture Plate: 96-well plate
Cell Confluency: 80%
Transfection Dose: 200 ng per well
Storage & Logistic
Storage Conditions: 2°C to 8°C, protect from light
Shipping Conditions: Ambient
Expiration Date of Liquid Product: 12 Months
Retest Date of Powder Product: 18 Months