mRNA-CD8A

Catalog No.	Gene	Scale	State
LS-RMCar-001	mRNA-CD8A	1mg	Lyophilized/Liquid

Catalog No. Gene Scale State
LS-RMCar-001 mRNA-CD8A 1mg Lyophilized/Liquid
Product Overview
mRNA-CD8A (Cluster of Differentiation 8 Alpha) is a ready-to-use mRNA product encoding the CD8α molecule. It is suitable for T cell immunology research and cell therapy development. CD8 is a hallmark marker of cytotoxic T lymphocytes and plays a critical role in T cell activation, as well as in antiviral and anti-tumor immune responses. It is widely used for T cell subset analysis and the development of immunotherapies.
Product Details
Concentration: 1mg/mL
Storage Buffer: ddH₂O ph=7.0
mRNA length: 1005 nt
Amino acid sequence size: 235 aa
Handling and Storage: store at – 80℃ for long term
Amino acid sequence
MALPVTALLLPLALLLHAARPSQFRVSPLDRTWNLGETVELKCQVLLSNPTSGCSWLFQPRGAAASPTFLLYLSQNKPKAAEGLDTQRFSGKRLGDTFVLTLSDFRRENEGYYFCSALSNSIMYFSHFVPVFLPAKPTTTPAPRPPTPAPTIASQPLSLRPEACRPAAGGAVHTRGLDFACDIYIWAPLAGTCGVLLLSLVITLYCNHRNRRRVCKCPRPVVKSGDKPSLSARYV
Cell Expression result:
Cell Line: A549
Culture Plate: 96-well plate
Cell Confluency: 80%
Transfection Dose: 200 ng per well
Storage & Logistic
Storage Conditions: 2°C to 8°C, protect from light
Shipping Conditions: Ambient
Expiration Date of Liquid Product: 12 Months
Retest Date of Powder Product: 18 Months