mRNA-mScarlet3

Cat.#	Gene	Scale	State
LS-RM028	mRNA-mScarlet3	1mg	Lyophilized/Liquid

Cat.# Gene Scale State

LS-RM028 mRNA-mScarlet3 1mg Lyophilized/Liquid
Product Overview

mRNA-mScarlet3 is a ready-to-use mRNA product encoding the mScarlet3 red fluorescent protein. It is suitable for mRNA delivery research, fluorescence tracing experiments, protein expression studies, and cell transfection assays. mScarlet3 is one of the brightest monomeric red fluorescent proteins currently available, featuring high photostability, rapid folding, and a long fluorescence lifetime. It is ideal for live-cell imaging, flow cytometry (FACS), and high-throughput screening applications.

Product Details

Storage Buffer: ddH₂O ph=7.0

mRNA length: 980 nt

Amino acid sequence size: 229 aa

Handling and Storage: store at – 80℃ for long term
Amino acid sequence

MDSTEAVIKEFMRFKVHMEGSMNGHEFEIEGEGEGRPYEGTQTAKLRVTKGGPLPFSWDILSPQFMYGSRAFTKHPADIPDYWKQSFPEGFKWERVMNFEDGGAVSVAQDTSLEDGTLIYKVKLRGTNFPPDGPVMQKKTMGWEASTERLYPEDVVLKGDIKMALRLKDGGRYLADFKTTYRAKKPVQMPGAFNIDRKLDITSHNEDYTVVEQYERSVARHSTGGSGGS
Storage & Logistic

Storage Conditions: 2°C to 8°C, protect from light

Shipping Conditions: Ambient

Expiration Date of Liquid Product: 12 Months

Retest Date of Powder Product: 18 Months