mRNA-mCherry

Cat.#	Gene	Scale	State
LS-RM034	mRNA-mCherry	1mg	Lyophilized/Liquid

Cat.# Gene Scale State

LS-RM034 mRNA-mCherry 1mg Lyophilized/Liquid
Product Overview

mRNA-mCherry is a ready-to-use mRNA product encoding the red fluorescent protein mCherry, which has an excitation wavelength of 587 nm and an emission wavelength of 610 nm.

Product Details

Storage Buffer: ddH₂O ph=7.0

mRNA length: 1008 nt

Amino acid sequence size: 236 aa

Handling and Storage: store at - 80 ℃ for long term
Amino acid sequence

MVSKGEEDNMAIIKEFMRFKVHMEGSVNGHEFEIEGEGEGRPYEGTQTAKLKVTKGGPLPFAWDILSPQFMYGSKAYVKHPADIPDYLKLSFPEGFKWERVMNFEDGGVVTVTQDSSLQDGEFIYKVKLRGTNFPSDGPVMQKKTMGWEASSERMYPEDGALKGEIKQRLKLKDGGHYDAEVKTTYKAKKPVQLPGAYNVNIKLDITSHNEDYTIVEQYERAEGRH STGGMDELYK
Cell Expression Result

Cell Line: 293T

Culture Plate: 96-well plate

Cell Confluency: 80%

Transfection Dose: 200 ng per well
Storage & Logistic

Storage Conditions: 2°C to 8°C, protect from light

Shipping Conditions: Ambient

Expiration Date of Liquid Product: 12 Months

Retest Date of Powder Product: 18 Months