mRNA-VEGF165

Cat.#	Gene	Scale	State
LS-RMAbt-046	mRNA-VEGF165	1mg	Lyophilized/Liquid

Cat.# Gene Scale State

LS-RMAbt-046 mRNA-VEGF165 1mg Lyophilized/Liquid
Product Overview

mRNA-VEGF165 (Vascular Endothelial Growth Factor 165) is a ready-to-use mRNA product encoding VEGF165, a key isoform of vascular endothelial growth factor. It is suitable for angiogenesis research, tissue repair studies, and anti-angiogenic therapy development. VEGF165 is a critical regulator of blood vessel formation and plays a central role in ischemic diseases, wound healing, and tumor angiogenesis. It is widely used in gene therapy applications and in the development of anti-VEGF therapeutic agents.

Product Details

Storage Buffer: ddH₂O ph=7.0

mRNA length: 873 nt

Amino acid sequence size: 191 aa

Handling and Storage: store at - 80 ℃ for long term
Amino acid sequence

MNFLLSWVHWSLALLLYLHHAKWSQAAPMAEGGGQNHHEVVKFMDVYQRSYCHPIETLVDIFQEYPDEIEYIFKPSCVPLMRCGGCCNDEGLECVPTEESNITMQIMRIKPHQGQHIGEMSFLQHNKCECRPKKDRARQENPCGPCSERRKHLFVQDPQTCKCSCKNTDSRCKARQLELNERTCRCDKPRR
Storage & Logistic

Storage Conditions: 2°C to 8°C, protect from light

Shipping Conditions: Ambient

Expiration Date of Liquid Product: 12 Months

Retest Date of Powder Product: 18 Months