mRNA-TSLP

Cat.#	Gene	Scale	State
LS-RMAbt-049	mRNA-TSLP	1mg	Lyophilized/Liquid

Cat.# Gene Scale State

LS-RMAbt-049 mRNA-TSLP 1mg Lyophilized/Liquid
Product Overview

mRNA-TSLP (Thymic Stromal Lymphopoietin) is a ready-to-use mRNA product encoding TSLP, a cytokine related to the IL-7 family. It is suitable for research on allergic diseases, asthma, and immune regulation. TSLP plays a pivotal role in Th2-type immune responses and allergic inflammation, such as asthma and atopic dermatitis. It is a key therapeutic target for anti-TSLP monoclonal antibodies, including Tezepelumab.

Product Details

Storage Buffer: ddH₂O ph=7.0

mRNA length: 777 nt

Amino acid sequence size: 159 aa

Handling and Storage: store at - 80 ℃ for long term
Amino acid sequence

MFPFALLYVLSVSFRKIFILQLVGLVLTYDFTNCDFEKIKAAYLSTISKDLITYMSGTKSTEFNNTVSCSNRPHCLTEIQSLTFNPTAGCASLAKEMFAMKTKAALAIWCPGYSETQINATQAMKKRRKRKVTTNKCLEQVSQLQGLWRRFNRPLLKQQ
Storage & Logistic

Storage Conditions: 2°C to 8°C, protect from light

Shipping Conditions: Ambient

Expiration Date of Liquid Product: 12 Months

Retest Date of Powder Product: 18 Months