mRNA-TNFSF9

Cat.#	Gene	Scale	State
LS-RMAbt-138	mRNA-TNFSF9	1mg	Lyophilized/Liquid

Cat.# Gene Scale State

LS-RMAbt-138 mRNA-TNFSF9 1mg Lyophilized/Liquid
Product Overview

mRNA-TNFSF9 is an in vitro transcribed (IVT) messenger RNA encoding the tumor necrosis factor ligand superfamily member 9 (TNFSF9, also known as 4-1BBL or CD137L), a transmembrane protein that binds to 4-1BB (CD137) on immune cells to provide potent co-stimulatory signals for T cell and NK cell activation. This synthetic mRNA enables controlled expression of TNFSF9 for research in cancer immunotherapy (enhancing CAR-T cell persistence), vaccine adjuvant development, and inflammatory disease models, with applications ranging from optimizing 4-1BB agonist therapies to studying immune checkpoint regulation in autoimmunity.

Product Details

Storage Buffer: ddH₂O ph=7.0

mRNA length: 1062 nt

Amino acid sequence size: 254 aa

Handling and Storage: store at – 80℃ for long term
Amino acid sequence

MEYASDASLDPEAPWPPAPRARACRVLPWALVAGLLLLLLLAAACAVFLACPWAVSGARASPGSAASPRLREGPELSPDDPAGLLDLRQGMFAQLVAQNVLLIDGPLSWYSDPGLAGVSLTGGLSYKEDTKELVVAKAGVYYVFFQLELRRVVAGEGSGSVSLALHLQPLRSAAGAAALALTVDLPPASSEARNSAFGFQGRLLHLSAGQRLGVHLHTEARARHAWQLTQGATVLGLFRVTPEIPAGLPSPRSE
Storage & Logistic

Storage Conditions: 2°C to 8°C, protect from light

Shipping Conditions: Ambient

Expiration Date of Liquid Product: 12 Months

Retest Date of Powder Product: 18 Months