mRNA-TNFSF4

Cat.#	Gene	Scale	State
LS-RMAbt-139	mRNA-TNFSF4	1mg	Lyophilized/Liquid

Cat.# Gene Scale State

LS-RMAbt-139 mRNA-TNFSF4 1mg Lyophilized/Liquid
Product Overview

mRNA-TNFSF4 is an in vitro transcribed (IVT) messenger RNA encoding the tumor necrosis factor ligand superfamily member 4 (TNFSF4, also known as OX40L or CD252), a membrane-bound protein expressed on antigen-presenting cells that binds to OX40 (CD134) to enhance T cell survival, proliferation, and cytokine production. This synthetic mRNA enables controlled expression of TNFSF4 for research in cancer immunotherapy (potentiating antitumor T cell responses), vaccine immunology (improving memory T cell generation), and autoimmune disease mechanisms (e.g., modulating pathogenic Th2 responses in asthma).

Product Details

Storage Buffer: ddH₂O ph=7.0

mRNA length: 849 nt

Amino acid sequence size: 183 aa

Handling and Storage: store at – 80℃ for long term
Amino acid sequence

MERVQPLEENVGNAARPRFERNKLLLVASVIQGLGLLLCFTYICLHFSALQVSHRYPRIQSIKVQFTEYKKEKGFILTSQKEDEIMKVQNNSVIINCDGFYLISLKGYFSQEVNISLHYQKDEEPLFQLKKVRSVNSLMVASLTYKDKVYLNVTTDNTSLDDFHVNGGELILIHQNPGEFCVL
Storage & Logistic

Storage Conditions: 2°C to 8°C, protect from light

Shipping Conditions: Ambient

Expiration Date of Liquid Product: 12 Months

Retest Date of Powder Product: 18 Months