mRNA-TNF

Cat.#	Gene	Scale	State
LS-RMAbt-060	mRNA-TNF	1mg	Lyophilized/Liquid

Cat.# Gene Scale State

LS-RMAbt-060 mRNA-TNF 1mg Lyophilized/Liquid
Product Overview

mRNA-TNF (Tumor Necrosis Factor, TNF-α) is a ready-to-use mRNA product encoding TNF-α, a key mediator of acute inflammatory responses. It is suitable for research on inflammation, immune regulation, and anti-tumor immunity. TNF-α plays a central role in apoptosis, immune responses, and tumor suppression. It is widely studied in the context of rheumatoid arthritis, Crohn’s disease, and cancer immunotherapy.

Product Details

Storage Buffer: ddH₂O ph=7.0

mRNA length: 1002 nt

Amino acid sequence size: 233 aa

Handling and Storage: store at - 80 ℃ for long term
Amino acid sequence

MSTESMIRDVELAEEALPKKTGGPQGSRRCLFLSLFSFLIVAGATTLFCLLHFGVIGPQREEFPRDLSLISPLAQAVRSSSRTPSDKPVAHVVANPQAEGQLQWLNRRANALLANGVELRDNQLVVPSEGLYLIYSQVLFKGQGCPSTHVLLTHTISRIAVSYQTKVNLLSAIKSPCQRETPEGAEAKPWYEPIYLGGVFQLEKGDRLSAEINRPDYLDFAESGQVYFGIIAL
Storage & Logistic

Storage Conditions: 2°C to 8°C, protect from light

Shipping Conditions: Ambient

Expiration Date of Liquid Product: 12 Months

Retest Date of Powder Product: 18 Months