mRNA-THPO

Cat.#	Gene	Scale	State
LS-RMFac-001	mRNA-THPO	1mg	Lyophilized/Liquid

Cat.# Gene Scale State

LS-RMFac-001 mRNA-THPO 1mg Lyophilized/Liquid
Product Overview

mRNA-THPO (Thrombopoietin, TPO) is a ready-to-use mRNA product encoding thrombopoietin (TPO), a key cytokine that regulates platelet production. It is suitable for research on thrombopoiesis, hematopoietic stem cell proliferation, and hematologic disorders. TPO plays a crucial role in the differentiation of hematopoietic stem cells and the generation of platelets, making it widely applicable in studies on thrombocytopenia and aplastic anemia.

Product Details

Storage Buffer: ddH₂O ph=7.0

mRNA length: 1359 nt

Amino acid sequence size: 353 aa

Handling and Storage: store at - 80 ℃ for long term
Amino acid sequence

MELTELLLVVMLLLTARLTLSSPAPPACDLRVLSKLLRDSHVLHSRLSQCPEVHPLPTPVLLPAVDFSLGEWKTQMEETKAQDILGAVTLLLEGVMAARGQLGPTCLSSLLGQLSGQVRLLLGALQSLLGTQLPPQGRTTAHKDPNAIFLSFQHLLRGKVRFLMLVGGSTLCVRRAPPTTAVPSRTSLVLTLNELPNRTSGLLETNFTASARTTGSGLLKWQQGFRAKIPGLLNQTSRSLDQIPGYLNRIHELLNGTRGLFPGPSRRTLGAPDISSGTSDTGSLPPNLQPGYSPSPTHPPTGQYTLFPLPPTLPTPVVQLHPLLPDPSAPTPTPTSPLLNTSYTHSQNLSQEG
Storage & Logistic

Storage Conditions: 2°C to 8°C, protect from light

Shipping Conditions: Ambient

Expiration Date of Liquid Product: 12 Months

Retest Date of Powder Product: 18 Months