mRNA-SCF(KITLG)

Cat.#	Gene	Scale	State
LS-RMFac-005	mRNA-SCF(KITLG)	1mg	Lyophilized/Liquid

Cat.# Gene Scale State

LS-RMFac-005 mRNA-SCF(KITLG) 1mg Lyophilized/Liquid
Product Overview

mRNA-SCF (Stem Cell Factor, KIT Ligand, KITLG) is a ready-to-use mRNA product encoding stem cell factor (SCF). It is suitable for research on hematopoietic stem cells, tissue regeneration, and cancer biology. SCF is a key regulator of hematopoietic stem cell proliferation and migration and plays a vital role in stem cell transplantation, as well as the development of melanocytes and germ cells.

Product Details

Storage Buffer: ddH₂O ph=7.0

mRNA length: 870 nt

Amino acid sequence size: 190 aa

Handling and Storage: store at - 80 ℃ for long term
Amino acid sequence

MKKTQTWILTCIYLQLLLFNPLVKTEGICRNRVTNNVKDVTKLVANLPKDYMITLKYVPGMDVLPSHCWISEMVVQLSDSLTDLLDKFSNISEGLSNYSIIDKLVNIVDDLVECVKENSSKDLKKSFKSPEPRLFTPEEFFRIFNRSIDAFKDFVVASETSDCVVSSTLSPEKDSRVSVTKPFMLPPVAA
Storage & Logistic

Storage Conditions: 2°C to 8°C, protect from light

Shipping Conditions: Ambient

Expiration Date of Liquid Product: 12 Months

Retest Date of Powder Product: 18 Months