mRNA-SB100X

Cat.#	Gene	Scale	State
LS-RMGe-006	mRNA-SB100X	1mg	Lyophilized/Liquid

Cat.# Gene Scale State

LS-RMGe-006 mRNA-SB100X 1mg Lyophilized/Liquid
Product Overview

mRNA-SB100X (Sleeping Beauty 100X Transposase) is a ready-to-use mRNA product encoding the Sleeping Beauty transposase. It is suitable for the development of non-viral gene transfer systems and cell therapy research. SB100X offers a highly efficient and safe platform for gene integration and has been widely applied in the development of T cell and NK cell therapies.

Product Details

Storage Buffer: ddH₂O ph=7.0

mRNA length: 1320 nt

Amino acid sequence size: 340 aa

Handling and Storage: store at - 80 ℃ for long term
Amino acid sequence

MGKSKEISQDLRKRIVDLHKSGSSLGAISKRLAVPRSSVQTIVRKYKHHGTTQPSYRSGRRRVLSPRDERTLVRKVQINPRTTAKDLVKMLEETGTKVSISTVKRVLYRHNLKGHSARKKPLLQNRHKKARLRFATAHGDKDRTFWRNVLWSDETKIELFGHNDHRYVWRKKGEACKPKNTIPTVKHGGGSIMLWGCFAAGGTGALHKIDGIMDAVQYVDILKQHLKTSVRKLKLGRKWVFQHDNDPKHTSKVVAKWLKDNKVKVLEWPSQSPDLNPIENLWAELKKRVRARRPTNLTQLHQLCQEEWAKIHPNYCGKLVEGYPKRLTQVKQFKGNATKY
Cell Expression Result

Cell Line: 293T

Culture Plate: 96-well plate

Cell Confluency: 80%

Transfection Dose: 200 ng per well
Storage & Logistic

Storage Conditions: 2°C to 8°C, protect from light

Shipping Conditions: Ambient

Expiration Date of Liquid Product: 12 Months

Retest Date of Powder Product: 18 Months