mRNA-PSCA

Cat.#	Gene	Scale	State
LS-RMAbt-156	mRNA-PSCA	1mg	Lyophilized/Liquid

Cat.# Gene Scale State

LS-RMAbt-156 mRNA-PSCA 1mg Lyophilized/Liquid
Product Overview

An in vitro transcribed (IVT) messenger RNA encoding Prostate Stem Cell Antigen (PSCA), a glycosylphosphatidylinositol (GPI)-anchored cell surface protein. This synthetic mRNA enables controlled expression of PSCA for research in prostate cancer biology, developing PSCA-targeted immunotherapies (e.g., CAR-T cells), and studying bladder and pancreatic carcinoma markers.

Product Details

Concentration: 1mg/mL

Storage Buffer: ddH₂O ph=7.0

mRNA length: 642 nt

Amino acid sequence size: 114 da

Handling and Storage: store at – 80℃ for long term
Amino acid sequence

MAGLALQPGTALLCYSCKAQVSNEDCLQVENCTQLGEQCWTARIRAVGLLTVISKGCSLNCVDDSQDYYVGKKNITCCDTDLCNASGAHALQPAAAILALLPALGLLLWGPGQL
Storage & Logistic

Storage Conditions: 2°C to 8°C, protect from light

Shipping Conditions: Ambient

Expiration Date of Liquid Product: 12 Months

Retest Date of Powder Product: 18 Months