mRNA-OCT4

Cat.#	Gene	Scale	State
LS-RMiPSC-001	mRNA-OCT4	1mg	Lyophilized/Liquid

Cat.# Gene Scale State

LS-RMiPSC-001 mRNA-OCT4 1mg Lyophilized/Liquid
Product Overview

mRNA-OCT4 is an in vitro transcribed (IVT) messenger RNA encoding the octamer-binding transcription factor 4 (OCT4, also known as POU5F1), a pivotal pluripotency regulator that maintains stem cell self-renewal and reprogramming capacity through modulation of target genes like NANOG and SOX2. This synthetic mRNA enables controlled expression of OCT4 for research in cellular reprogramming (iPS generation), stem cell maintenance, and development of regenerative therapies targeting tissue repair and organoid generation.

Product Details

Storage Buffer: ddH₂O ph=7.0

mRNA length: 1380 nt

Amino acid sequence size: 360 aa

Handling and Storage: store at - 80 ℃ for long term
Amino acid sequence

MAGHLASDFAFSPPPGGGGDGPGGPEPGWVDPRTWLSFQGPPGGPGIGPGVGPGSEVWGIPPCPPPYEFCGGMAYCGPQVGVGLVPQGGLETSQPEGEAGVGVESNSDGASPEPCTVTPGAVKLEKEKLEQNPEESQDIKALQKELEQFAKLLKQKRITLGYTQADVGLTLGVLFGKVFSQTTICRFEALQLSFKNMCKLRPLLQKWVEEADNNENLQEICKAETLVQARKRKRTSIENRVRGNLENLFLQCPKPTLQQISHIAQQLGLEKDVVRVWFCNRRQKGKRSSSDYAQREDFEAAGSPFSGGPVSFPLAPGPHFGTPGYGSPHFTALYSSVPFPEGEAFPPVSVTTLGSPMHSN
Storage & Logistic

Storage Conditions: 2°C to 8°C, protect from light

Shipping Conditions: Ambient

Expiration Date of Liquid Product: 12 Months

Retest Date of Powder Product: 18 Months