mRNA-NCR1

Cat.#	Gene	Scale	State
LS-RMAbt-077	mRNA-NCR1	1mg	Lyophilized/Liquid

Cat.# Gene Scale State

LS-RMAbt-077 mRNA-NCR1 1mg Lyophilized/Liquid
Product Overview

mRNA-NCR1 is an in vitro transcribed (IVT) messenger RNA encoding the natural cytotoxicity triggering receptor 1 (NCR1, also known as NKp46), a key activating receptor primarily expressed on natural killer (NK) cells that mediates target cell recognition and cytotoxicity. This synthetic mRNA enables controlled expression of NCR1 for research in NK cell biology, tumor immunosurveillance mechanisms, and development of NK cell-based immunotherapies against cancer and viral infections.

Product Details

Storage Buffer: ddH₂O ph=7.0

mRNA length: 1212 nt

Amino acid sequence size: 304 aa

Handling and Storage: store at – 80℃ for long term
Amino acid sequence

MSSTLPALLCVGLCLSQRISAQQQTLPKPFIWAEPHFMVPKEKQVTICCQGNYGAVEYQLHFEGSLFAVDRPKPPERINKVQFYIPDMNSRMAGQYSCIYRVGELWSEPSNLLDLVVTEMYDTPTLSVHPGPEVISGEKVTFYCRLDTATSMFLLLKEGRSSHVQRGYGKVQAEFPLGPVTTAHRGTYRCFGSYNNHAWSFPSEPVKLLVTGDIENTSLAPEDPTFPADTWGTYLLTTETGLQKDHALWDHTAQNLLRMGLAFLVLVALVWFLVEDWLSRKRTRERASRASTWEGRRRLNTQTL
Cell Expression Result

Cell Line: A549

Culture Plate: 96-well plate

Cell Confluency: 80%

Transfection Dose: 200 ng per wel
Storage & Logistic

Storage Conditions: 2°C to 8°C, protect from light

Shipping Conditions: Ambient

Expiration Date of Liquid Product: 12 Months

Retest Date of Powder Product: 18 Months