mRNA-NANOG

Cat.#	Gene	Scale	State
LS-RMiPSC-007	mRNA-NANOG	1mg	Lyophilized/Liquid

Cat.# Gene Scale State

LS-RMiPSC-007 mRNA-NANOG 1mg Lyophilized/Liquid
Product Overview

mRNA-NANOG is an in vitro transcribed (IVT) messenger RNA encoding the NANOG homeobox protein, a core pluripotency transcription factor that cooperates with OCT4 and SOX2 to maintain embryonic stem cell self-renewal and suppress differentiation. This synthetic mRNA enables controlled expression of NANOG for research in cellular reprogramming (iPS generation), germ cell development, and regenerative medicine applications targeting tissue stem cell expansion.

Product Details

Storage Buffer: ddH₂O ph=7.0

mRNA length: 1215 nt

Amino acid sequence size: 305 aa

Handling and Storage: store at - 80 ℃ for long term
Amino acid sequence

MSVDPACPQSLPCFEASDCKESSPMPVICGPEENYPSLQMSSAEMPHTETVSPLPSSMDLLIQDSPDSSTSPKGKQPTSAEKSVAKKEDKVPVKKQKTRTVFSSTQLCVLNDRFQRQKYLSLQQMQELSNILNLSYKQVKTWFQNQRMKSKRWQKNNWPKNSNGVTQKASAPTYPSLYSSYHQGCLVNPTGNLPMWSNQTWNNSTWSNQTQNIQSWSNHSWNTQTWCTQSWNNQAWNSPFYNCGEESLQSCMQFQPNSPASDLEAALEAAGEGLNVIQQTTRYFSTPQTMDLFLNYSMNMQPEDV
Storage & Logistic

Storage Conditions: 2°C to 8°C, protect from light

Shipping Conditions: Ambient

Expiration Date of Liquid Product: 12 Months

Retest Date of Powder Product: 18 Months