mRNA-LTA

Cat.#	Gene	Scale	State
LS-RMFac-017	mRNA-LTA	1mg	Lyophilized/Liquid

Cat.# Gene Scale State

LS-RMFac-017 mRNA-LTA 1mg Lyophilized/Liquid
Product Overview

mRNA-LTA (Lymphotoxin Alpha, TNF-β) is a ready-to-use mRNA product encoding lymphotoxin alpha (LTA, also known as TNF-β), a member of the TNF superfamily. It is suitable for research on inflammation, immune regulation, and anti-tumor immunity. LTA plays a critical role in apoptosis, immune modulation, and anti-tumor immune responses, making it a valuable tool for studies on chronic inflammation and cancer.

Product Details

Storage Buffer: ddH₂O ph=7.0

mRNA length: 915 nt

Amino acid sequence size: 205 aa

Handling and Storage: store at - 80 ℃ for long term
Amino acid sequence

MTPPERLFLPRVCGTTLHLLLLGLLLVLLPGAQGLPGVGLTPSAAQTARQHPKMHLAHSTLKPAAHLIGDPSKQNSLLWRANTDRAFLQDGFSLSNNSLLVPTSGIYFVYSQVVFSGKAYSPKATSSPLYLAHEVQLFSSQYPFHVPLLSSQKMVYPGLQEPWLHSMYHGAAFQLTQGDQLSTHTDGIPHLVLSPSTVFFGAFAL
Storage & Logistic

Storage Conditions: 2°C to 8°C, protect from light

Shipping Conditions: Ambient

Expiration Date of Liquid Product: 12 Months

Retest Date of Powder Product: 18 Months