mRNA-LIN28A

Cat.#	Gene	Scale	State
LS-RMiPSC-006	mRNA-LIN28A	1mg	Lyophilized/Liquid

Cat.# Gene Scale State

LS-RMiPSC-006 mRNA-LIN28A 1mg Lyophilized/Liquid
Product Overview

mRNA-LIN28A is an in vitro transcribed (IVT) messenger RNA encoding the LIN28 homolog A (LIN28A), an RNA-binding protein that post-transcriptionally regulates let-7 microRNA biogenesis and promotes pluripotency by enhancing mRNA translation of core stemness factors. This synthetic mRNA enables controlled expression of LIN28A for research in somatic cell reprogramming, primordial germ cell development, and regenerative medicine strategies targeting tissue repair and metabolic regulation.

Product Details

Storage Buffer: ddH₂O ph=7.0

mRNA length: 927 nt

Amino acid sequence size: 209 aa

Handling and Storage: store at - 80 ℃ for long term
Amino acid sequence

MGSVSNQQFAGGCAKAAEEAPEEAPEDAARAADEPQLLHGAGICKWFNVRMGFGFLSMTARAGVALDPPVDVFVHQSKLHMEGFRSLKEGEAVEFTFKKSAKGLESIRVTGPGGVFCIGSERRPKGKSMQKRRSKGDRCYNCGGLDHHAKECKLPPQPKKCHFCQSISHMVASCPLKAQQGPSAQGKPTYFREEEEEIHSPTLLPEAQN
Storage & Logistic

Storage Conditions: 2°C to 8°C, protect from light

Shipping Conditions: Ambient

Expiration Date of Liquid Product: 12 Months

Retest Date of Powder Product: 18 Months