Products

Products

mRNA-LAG3

Cat.# Gene Scale State
LS-RMAbt-035 mRNA-LAG3 1mg Lyophilized/Liquid
  • Description
  • Product Overview
  • Sequence
  • Data Chart
  • Storage & Logistic
  • Documents
  • Cat.# Gene Scale State
    LS-RMAbt-035 mRNA-LAG3 1mg Lyophilized/Liquid
  • Product Overview

    mRNA-LAG3 (Lymphocyte Activation Gene-3, LAG-3) is a ready-to-use mRNA product encoding the immune checkpoint receptor LAG-3. It is suitable for T cell immune regulation research, tumor immunology studies, and anti-LAG-3 immunotherapy development. LAG-3 functions as an immune checkpoint receptor that negatively regulates T cell activity to maintain immune tolerance. It holds significant research value in the tumor microenvironment and autoimmune diseases and is a key target for immune checkpoint inhibitors such as Relatlimab.

    Product Details

    Storage Buffer: ddH2O ph=7.0

    mRNA length: 1875 nt

    Amino acid sequence size: 525 aa

    Handling and Storage: store at – 80℃ for long term

  • Amino acid sequence

    MWEAQFLGLLFLQPLWVAPVKPLQPGAEVPVVWAQEGAPAQLPCSPTIPLQDLSLLRRAGVTWQHQPDSGPPAAAPGHPLAPGPHPAAPSSWGPRPRRYTVLSVGPGGLRSGRLPLQPRVQLDERGRQRGDFSLWLRPARRADAGEYRAAVHLRDRALSCRLRLRLGQASMTASPPGSLRASDWVILNCSFSRPDRPASVHWFRNRGQGRVPVRESPHHHLAESFLFLPQVSPMDSGPWGCILTYRDGFNVSIMYNLTVLGLEPPTPLTVYAGAGSRVGLPCRLPAGVGTRSFLTAKWTPPGGGPDLLVTGDNGDFTLRLEDVSQAQAGTYTCHIHLQEQQLNATVTLAIITVTPKSFGSPGSLGKLLCEVTPVSGQERFVWSSLDTPSQRSFSGPWLEAQEAQLLSQPWQCQLYQGERLLGAAVYFTELSSPGAQRSGRAPGALPAGHLLLFLILGVLSLLLLVTGAFGFHLWRRQWRPRRFSALEQGIHPPQAQSKIEELEQEPEPEPEPEPEPEPEPEPEQL

  • Storage & Logistic

    Storage Conditions: 2°C to 8°C, protect from light

    Shipping Conditions: Ambient

    Expiration Date of Liquid Product: 12 Months

    Retest Date of Powder Product: 18 Months

Get in Touch with Levostar

Please send us your request or email to support@levostar.com, our team will contact you as soon as possible.

Submit

Download Application Note

Collecting your relevant information will help Levostar provide you with better service.

图片名称

Get in Touch with Levostar

Please send us your request or email to support@levostar.com, our team will contact you as soon as possible.

Submit
%{tishi_zhanwei}%