mRNA-KLRK1

Cat.#	Gene	Scale	State
LS-RMAbt-068	mRNA-KLRK1	1mg	Lyophilized/Liquid

Cat.# Gene Scale State

LS-RMAbt-068 mRNA-KLRK1 1mg Lyophilized/Liquid
Product Overview

mRNA-KLRK1 is an in vitro transcribed (IVT) messenger RNA encoding KLRK1 (also known as NKG2D), a critical activating receptor expressed on natural killer (NK) cells and subsets of T cells. This synthetic mRNA enables controlled expression of the NKG2D receptor for research in NK cell biology, cancer immunotherapy development, and studies of viral immune evasion mechanisms, particularly in the context of NKG2D ligand-mediated tumor recognition and cytotoxicity.

Product Details

Storage Buffer: ddH₂O ph=7.0

mRNA length: 948 nt

Amino acid sequence size: 216 aa

Handling and Storage: store at – 80℃ for long term
Amino acid sequence

MGWIRGRRSRHSWEMSEFHNYNLDLKKSDFSTRWQKQRCPVVKSKCRENASPFFFCCFIAVAMGIRFIIMVTIWSAVFLNSLFNQEVQIPLTESYCGPCPKNWICYKNNCYQFFDESKNWYESQASCMSQNASLLKVYSKEDQDLLKLVKSYHWMGLVHIPTNGSWQW EDGSILSPNLLTIIEMQKGDCALYASSFKGYIENCSTPNTYICMQRTV
Cell Expression result:

Cell Line: A549

Culture Plate: 96-well plate

Cell Confluency: 80%

Transfection Dose: 200 ng per well
Storage & Logistic

Storage Conditions: 2°C to 8°C, protect from light

Shipping Conditions: Ambient

Expiration Date of Liquid Product: 12 Months

Retest Date of Powder Product: 18 Months