mRNA-IL7

Cat.#	Gene	Scale	State
LS-RMFac-011	mRNA-IL7	1mg	Lyophilized/Liquid

Cat.# Gene Scale State

LS-RMFac-011 mRNA-IL7 1mg Lyophilized/Liquid
Product Overview

mRNA-IL7 (Interleukin-7) is a ready-to-use mRNA product encoding IL-7, a key cytokine involved in T cell development and survival. It is suitable for research on T cell biology, immune regulation, and cancer immunotherapy. IL-7 plays a critical role in supporting T cell maturation, homeostasis, and expansion, making it a valuable target in studies focused on T cell reconstitution and immunotherapeutic strategies against cancer.

Product Details

Storage Buffer: ddH₂O ph=7.0

mRNA length: 831 nt

Amino acid sequence size: 177 aa

Handling and Storage: store at - 80 ℃ for long term
Amino acid sequence

MFHVSFRYIFGLPPLILVLLPVASSDCDIEGKDGKQYESVLMVSIDQLLDSMKEIGSNCLNNEFNFFKRHICDANKEGMFLFRAARKLRQFLKMNSTGDFDLHLLKVSEGTTILLNCTGQVKGRKPAALGEAQPTKSLEENKSLKEQKKLNDLCFLKRLLQEIKTCWNKILMGTKEH
Storage & Logistic

Storage Conditions: 2°C to 8°C, protect from light

Shipping Conditions: Ambient

Expiration Date of Liquid Product: 12 Months

Retest Date of Powder Product: 18 Months