mRNA-IL6R

Cat.#	Gene	Scale	State
LS-RMAbt-022	mRNA-IL6R	1mg	Lyophilized/Liquid

Order Now

Contact

Description
Product Overview
Sequence
Data Chart
Storage & Logistic
Documents

Cat.# Gene Scale State

LS-RMAbt-022 mRNA-IL6R 1mg Lyophilized/Liquid
Product Overview

mRNA-IL6R is a ready-to-use mRNA product encoding the Interleukin-6 Receptor (IL6R). It is suitable for research on chronic inflammation, immune regulation, and cancer-related inflammation. IL6R is a key receptor in the IL-6 signaling pathway and plays an important role in acute inflammatory responses, B cell activation, and tumor-associated inflammation. Dysregulation of IL-6 signaling is closely associated with diseases such as rheumatoid arthritis, Crohn's disease, and various cancers, making IL6R a major target in the development of anti-IL-6 therapies, including monoclonal antibodies like Tocilizumab.

Product Details

Storage Buffer: ddH₂O ph=7.0

mRNA length: 1704 nt

Amino acid sequence size: 468 aa

Handling and Storage: store at – 80℃ for long term
Amino acid sequence

MLAVGCALLAALLAAPGAALAPRRCPAQEVARGVLTSLPGDSVTLTCPGVEPEDNATVHWVLRKPAAGSHPSRWAGMGRRLLLRSVQLHDSGNYSCYRAGRPAGTVHLLVDVPPEEPQLSCFRKSPLSNVVCEWGPRSTPSLTTKAVLLVRKFQNSPAEDFQEPCQYSQESQKFSCQLAVPEGDSSFYIVSMCVASSVGSKFSKTQTFQGCGILQPDPPANITVTAVARNPRWLSVTWQDPHSWNSSFYRLRFELRYRAERSKTFTTWMVKDLQHHCVIHDAWSGLRHVVQLRAQEEFGQGEWSEWSPEAMGTPWTESRSPPAENEVSTPMQALTTNKDDDNILFRDSANATSLPVQDSSSVPLPTFLVAGGSLAFGTLLCIAIVLRFKKTWKLRALKEGKTSMHPPYSLGQLVPERPRPTPVLVPLISPPVSPSSLGSDNTSSHNRPDARDPRSPYDISNTDYFFPR
Storage & Logistic

Storage Conditions: 2°C to 8°C, protect from light

Shipping Conditions: Ambient

Expiration Date of Liquid Product: 12 Months

Retest Date of Powder Product: 18 Months