mRNA-IL6

Cat.#	Gene	Scale	State
LS-RMAbt-056	mRNA-IL6	1mg	Lyophilized/Liquid

Cat.# Gene Scale State

LS-RMAbt-056 mRNA-IL6 1mg Lyophilized/Liquid
Product Overview

mRNA-IL6 (Interleukin-6) is a ready-to-use mRNA product encoding IL-6, a key cytokine involved in acute-phase responses and inflammatory signaling. It is suitable for research on chronic inflammation, cancer-related inflammation, and immune regulation. IL-6 plays a pivotal role in the pathogenesis of rheumatoid arthritis, Crohn’s disease, and various cancers, making it an important target for IL-6-directed therapies such as Tocilizumab.

Product Details

Storage Buffer: ddH₂O ph=7.0

mRNA length: 936 nt

Amino acid sequence size: 212 aa

Handling and Storage: store at - 80 ℃ for long term
Amino acid sequence

MNSFSTSAFGPVAFSLGLLLVLPAAFPAPVPPGEDSKDVAAPHRQPLTSSERIDKQIRYILDGISALRKETCNKSNMCESSKEALAENNLNLPKMAEKDGCFQSGFNEETCLVKIITGLLEFEVYLEYLQNRFESSEEQARAVQMSTKVLIQFLQKKAKNLDAITTPDPTTNASLLTKLQAQNQWLQDMTTHLILRSFKEFLQSSLRALRQM
Storage & Logistic

Storage Conditions: 2°C to 8°C, protect from light

Shipping Conditions: Ambient

Expiration Date of Liquid Product: 12 Months

Retest Date of Powder Product: 18 Months