mRNA-IL3RA

Cat.#	Gene	Scale	State
LS-RMAbt-125	mRNA-IL3RA	1mg	Lyophilized/Liquid

Cat.# Gene Scale State

LS-RMAbt-125 mRNA-IL3RA 1mg Lyophilized/Liquid
Product Overview

mRNA-IL3RA is an in vitro transcribed (IVT) messenger RNA encoding the interleukin-3 receptor alpha chain (IL-3Rα, CD123), the specific ligand-binding subunit of the IL-3 receptor complex that regulates hematopoietic cell survival and proliferation through JAK/STAT signaling. This synthetic mRNA enables controlled expression of IL-3Rα for research in acute myeloid leukemia (AML) biology, dendritic cell differentiation protocols, and development of CD123-targeted therapies (e.g., CAR-T cells or antibody-drug conjugates) for hematologic malignancies.

Product Details

Storage Buffer: ddH₂O ph=7.0

mRNA length: 1434 nt

Amino acid sequence size: 378 aa

Handling and Storage: store at – 80℃ for long term
Amino acid sequence

MVLLWLTLLLIALPCLLQTKEDPNPPITNLRMKAKAQQLTWDLNRNVTDIECVKDADYSMPAVNNSYCQFGAISLCEVTNYTVRVANPPFSTWILFPENSGKPWAGAENLTCWIHDVDFLSCSWAVGPGAPADVQYDLYLNVANRRQQYECLHYKTDAQGTRIGCRFDDISRLSSGSQSSHILVRGRSAAFGIPCTDKFVVFSQIEILTPPNMTAKCNKTHSFMHWKMRSHFNRKFRYELQIQKRMQPVITEQVRDRTSFQLLNPGTYTVQIRARERVYEFLSAWSTPQRFECDQEEGANTRAWRTSLLIALGTLLALVCVFVICRRYLVMQRLFPRIPHMKDPI GDSFQNDKLVVWEAGKAGLEECLVTEVQVVQKT
Storage & Logistic

Storage Conditions: 2°C to 8°C, protect from light

Shipping Conditions: Ambient

Expiration Date of Liquid Product: 12 Months

Retest Date of Powder Product: 18 Months