mRNA-IL3

Cat.#	Gene	Scale	State
LS-RMFac-010	mRNA-IL3	1mg	Lyophilized/Liquid

Cat.# Gene Scale State

LS-RMFac-010 mRNA-IL3 1mg Lyophilized/Liquid
Product Overview

mRNA-IL3 (Interleukin-3) is a ready-to-use mRNA product encoding IL-3, a key cytokine involved in hematopoietic cell proliferation and differentiation. It is suitable for research on hematopoietic stem cells, immune regulation, and inflammation. IL-3 plays an important role in the development and functional regulation of macrophages, eosinophils, and mast cells, making it valuable for studies in hematopoiesis and immune cell biology.

Product Details

Storage Buffer: ddH₂O ph=7.0

mRNA length: 756 nt

Amino acid sequence size: 152 aa

Handling and Storage: store at - 80 ℃ for long term
Amino acid sequence

MSRLPVLLLLQLLVRPGLQAPMTQTTPLKTSWVNCSNMIDEIITHLKQPPLPLLDFNN LNGEDQDILMENNLRRPNLEAFNRAVKSLQNASAIESILKNLLPCLPLATAAPTRHPIH IKDGDWNEFRRKLTFYLKTLENAQAQQTTLSLAIF
Storage & Logistic

Storage Conditions: 2°C to 8°C, protect from light

Shipping Conditions: Ambient

Expiration Date of Liquid Product: 12 Months

Retest Date of Powder Product: 18 Months