mRNA-IL21

Cat.#	Gene	Scale	State
LS-RMFac-013	mRNA-IL21	1mg	Lyophilized/Liquid

Cat.# Gene Scale State

LS-RMFac-013 mRNA-IL21 1mg Lyophilized/Liquid
Product Overview

mRNA-IL21 (Interleukin-21) is a ready-to-use mRNA product encoding IL-21, a key cytokine involved in immune regulation. It is suitable for research on B cell function, T cell modulation, and cancer immunotherapy. IL-21 plays a crucial role in B cell differentiation, antibody production, and anti-tumor immune responses, making it valuable for the development of cancer immunotherapies and the study of autoimmune diseases.

Product Details

Storage Buffer: ddH₂O ph=7.0

mRNA length: 786 nt

Amino acid sequence size: 162 aa

Handling and Storage: store at - 80 ℃ for long term
Amino acid sequence

MRSSPGNMERIVICLMVIFLGTLVHKSSSQGQDRHMIRMRQLIDIVDQLKNYVNDLVPEFLPAPEDVETNCEWSAFSCFQKAQLKSANTGNNERIINVSIKKLKRKPPSTNAGRRQKHRLTCPSCDSYEKKPPKEFLERFKSLLQKMIHQHLSSRTHGSEDS
Storage & Logistic

Storage Conditions: 2°C to 8°C, protect from light

Shipping Conditions: Ambient

Expiration Date of Liquid Product: 12 Months

Retest Date of Powder Product: 18 Months