mRNA-IL2

Cat.#	Gene	Scale	State
LS-RMAbt-053	mRNA-IL2	1mg	Lyophilized/Liquid

Cat.# Gene Scale State

LS-RMAbt-053 mRNA-IL2 1mg Lyophilized/Liquid
Product Overview

mRNA-IL2 (Interleukin-2) is a ready-to-use mRNA product encoding IL-2, a key T cell growth factor. It is suitable for studies on T cell proliferation, immune regulation, and cancer immunotherapy. IL-2 plays a crucial role in the proliferation and activation of T cells and NK cells and is widely used in CAR-T cell expansion and the development of anti-tumor immunotherapies.

Product Details

Storage Buffer: ddH₂O ph=7.0

mRNA length: 759 nt

Amino acid sequence size: 153 aa

Handling and Storage: store at - 80 ℃ for long term
Amino acid sequence

MYRMQLLSCIALSLALVTNSAPTSSSTKKTQLQLEHLLLDLQMILNGINNYKNPKLTRMLTFKFYMPKKATELKHLQCLEEELKPLEEVLNLAQSKNFHLRPRDLISNINVIVLELK GSETTFMCEYADETATIVEFLNRWITFCQSIISTLT
Storage & Logistic

Storage Conditions: 2°C to 8°C, protect from light

Shipping Conditions: Ambient

Expiration Date of Liquid Product: 12 Months

Retest Date of Powder Product: 18 Months