mRNA-IL15

Cat.#	Gene	Scale	State
LS-RMFac-012	mRNA-IL15	1mg	Lyophilized/Liquid

Cat.# Gene Scale State

LS-RMFac-012 mRNA-IL15 1mg Lyophilized/Liquid
Product Overview

mRNA-IL15 (Interleukin-15) is a ready-to-use mRNA product encoding IL-15, a key cytokine that supports the proliferation and activation of NK cells and CD8+ memory T cells. It is suitable for research on NK cell function, cancer immunotherapy, and antiviral immunity. IL-15 plays a crucial role in enhancing cytotoxic immune responses and is widely used in the development of immunotherapeutic strategies for cancer and viral infections.

Product Details

Storage Buffer: ddH₂O ph=7.0

mRNA length: 786 nt

Amino acid sequence size: 162 aa

Handling and Storage: store at - 80 ℃ for long term
Amino acid sequence

MRISKPHLRSISIQCYLCLLLNSHFLTEAGIHVFILGCFSAGLPKTEANWVNVISDLKKIEDLIQSMHIDATLYTESDVHPSCKVTAMKCFLLELQVISLESGDASIHDTVENLIILANNSLSSNGNVTESGCKECEELEEKNIKEFLQSFVHIVQMFINTS
Storage & Logistic

Storage Conditions: 2°C to 8°C, protect from light

Shipping Conditions: Ambient

Expiration Date of Liquid Product: 12 Months

Retest Date of Powder Product: 18 Months