mRNA-IGF1

Cat.#	Gene	Scale	State
LS-RMFac-002	mRNA-IGF1	1mg	Lyophilized/Liquid

Cat.# Gene Scale State

LS-RMFac-002 mRNA-IGF1 1mg Lyophilized/Liquid
Product Overview

mRNA-IGF1 (Insulin-Like Growth Factor 1, IGF-1) is a ready-to-use mRNA product encoding IGF-1. It is suitable for research on cell proliferation, metabolic regulation, and regenerative medicine. IGF-1 plays a crucial role in cell growth, metabolism, and tissue repair, making it an important target in studies of metabolic disorders, neurodegenerative diseases, and tissue regeneration.

Product Details

Storage Buffer: ddH₂O ph=7.0

mRNA length: 711 nt

Amino acid sequence size: 137 aa

Handling and Storage: store at - 80 ℃ for long term
Amino acid sequence

MITPTVKMHTMSSSHLFYLALCLLTFTSSATAGPETLCGAELVDALQFVCGDRGFYFNKPTGYGSSSRRAPQTGIVDECCFRSCDLRRLEMYCAPLKPAKSARSVRAQRHTDMPKTQKEVHLKNASRGSAGNKNYRM
Storage & Logistic

Storage Conditions: 2°C to 8°C, protect from light

Shipping Conditions: Ambient

Expiration Date of Liquid Product: 12 Months

Retest Date of Powder Product: 18 Months