mRNA-IFNG

Cat.#	Gene	Scale	State
LS-RMAbt-052	mRNA-IFNG	1mg	Lyophilized/Liquid

Cat.# Gene Scale State

LS-RMAbt-052 mRNA-IFNG 1mg Lyophilized/Liquid
Product Overview

mRNA-IFNG (Interferon Gamma) is a ready-to-use mRNA product encoding IFN-γ, a type II interferon. It is suitable for T cell immune function studies, anti-tumor research, and anti-infection investigations. IFN-γ plays a critical role in macrophage activation, cytotoxic immune responses, and antiviral defense. It is widely used in cancer immunotherapy and research on chronic infectious diseases.

Product Details

Storage Buffer: ddH₂O ph=7.0

mRNA length: 798 nt

Amino acid sequence size: 166 aa

Handling and Storage: store at - 80 ℃ for long term
Amino acid sequence

MKYTSYILAFQLCIVLGSLGCYCQDPYVKEAENLKKYFNAGHSDVADNGTLFLGILKNWKEESDRKIMQSQIVSFYFKLFKNFKDDQSIQKSVETIKEDMNVKFFNSNKKKRDDFEKLTNYSVTDLNVQRKAIHELIQVMAELSPAAKTGKRKRSQMLFRGRRASQ
Storage & Logistic

Storage Conditions: 2°C to 8°C, protect from light

Shipping Conditions: Ambient

Expiration Date of Liquid Product: 12 Months

Retest Date of Powder Product: 18 Months