mRNA-ICOSLG

Cat.#	Gene	Scale	State
LS-RMAbt-136	mRNA-ICOSLG	1mg	Lyophilized/Liquid

Cat.# Gene Scale State

LS-RMAbt-136 mRNA-ICOSLG 1mg Lyophilized/Liquid
Product Overview

mRNA-ICOSLG is an in vitro transcribed (IVT) messenger RNA encoding the inducible T-cell costimulator ligand (ICOSLG, also known as B7-H2 or CD275), a B7-family protein expressed on antigen-presenting cells that binds ICOS (CD278) to regulate T follicular helper cell responses and germinal center formation. This synthetic mRNA enables controlled expression of ICOSLG for research in vaccine adjuvant development, autoimmune disease models (e.g., lupus), and optimization of CAR-T cell therapies through costimulatory signaling enhancement.

Product Details

Storage Buffer: ddH₂O ph=7.0

mRNA length: 1206 nt

Amino acid sequence size: 302 aa

Handling and Storage: store at – 80℃ for long term
Amino acid sequence

MRLGSPGLLFLLFSSLRADTQEKEVRAMVGSDVELSCACPEGSRFDLNDVYVYWQTSESKTVVTYHIPQNSSLENVDSRYRNRALMSPAGMLRGDFSLRLFNVTPQDEQKFHCLVLSQSLGFQEVLSVEVTLHVAANFSVPVVSAPHSPSQDELTFTCTSINGYPRPNVYWINKTDNSLLDQALQNDTVFLNMRGLYDVVSVLRIARTPSVNIGCCIENVLLQQNLTVGSQTGNDIGERDKITENPVSTGEKNAATWSILAVLCLLVVVAVAIGWVCRDRCLQHSYAGAWAVSPETELTGHV
Storage & Logistic

Storage Conditions: 2°C to 8°C, protect from light

Shipping Conditions: Ambient

Expiration Date of Liquid Product: 12 Months

Retest Date of Powder Product: 18 Months