mRNA-ICOS

Cat.#	Gene	Scale	State
LS-RMAbt-135	mRNA-ICOS	1mg	Lyophilized/Liquid

Cat.# Gene Scale State

LS-RMAbt-135 mRNA-ICOS 1mg Lyophilized/Liquid
Product Overview

mRNA-ICOS is an in vitro transcribed (IVT) messenger RNA encoding the inducible T-cell costimulator (ICOS, CD278), a CD28-family costimulatory receptor that enhances T follicular helper (Tfh) cell differentiation and germinal center responses through PI3K signaling. This synthetic mRNA enables controlled expression of ICOS for research in vaccine immunology, autoimmune disease mechanisms, and development of ICOS-targeted immunotherapies (e.g., agonist antibodies for cancer or antagonist biologics for autoimmunity).

Product Details

Storage Buffer: ddH₂O ph=7.0

mRNA length: 897 nt

Amino acid sequence size: 199 aa

Handling and Storage: store at – 80℃ for long term
Amino acid sequence

MKSGLWYFFLFCLRIKVLTGEINGSANYEMFIFHNGGVQILCKYPDIVQQFKMQLLKGGQILCDLTKTKGSGNTVSIKSLKFCHSQLSNNSVSFFLYNLDHSHANYYFCNLSIFDPPPFKVTLTGGYLHIYESQLCCQLKFWLPIGCAAFVVVCILGCILICWLTKKKYSSSVHDP NGEYMFMRAVNTAKKSRLTDVTL
Storage & Logistic

Storage Conditions: 2°C to 8°C, protect from light

Shipping Conditions: Ambient

Expiration Date of Liquid Product: 12 Months

Retest Date of Powder Product: 18 Months