mRNA-Gaussia Luciferase

Cat.#	Gene	Scale	State
LS-RM030	mRNA-Gaussia Luciferase	1mg	Lyophilized/Liquid

Cat.# Gene Scale State

LS-RM030 mRNA-Gaussia Luciferase 1mg Lyophilized/Liquid
Product Overview

mRNA-Gaussia Luciferase (mRNA-GLuc) is a ready-to-use mRNA product encoding Gaussia luciferase (GLuc). It is suitable for in vitro transcription (IVT) assays, mRNA delivery studies, reporter gene detection, in vivo monitoring of secreted luciferase, and high-throughput screening experiments. GLuc is a highly sensitive secreted luciferase that enables real-time, non-lytic bioluminescence analysis by measuring luciferase activity in culture media or biological fluids, making it ideal for both in vitro and in vivo applications.

Product Details

Storage Buffer: ddH₂O ph=7.0

mRNA length: 855 nt

Amino acid sequence size: 185 aa

Handling and Storage: store at - 80 ℃ for long term
Amino acid sequence

MGVKVLFALICIAVAEAKPTENNEDFNIVAVASNFATTDLDADRGKLPGKKLPLEVLKELEANARKAGCTRGCLICLSHIKCTPKMKKFIPGRCHTYEGDKESAQGGIGEAIVDIPEIPGFKDLEPLEQFIAQVDLCVDCTTGCLKGLANVQCSDLLKKWLPQRCATFASKIQGQVDKIKGAGGD

Cell Line: 293T Culture

Plate: 96-well plate

Cell Confluency: 80%

Transfection Dose: 200 ng per well

Result（The assayed sample is cell culture supernatant）

Name	Lysis Buffer（μL）	Dilution Factor	Volume Tested（μL）	Luciferase Assay Substrate（μL）	Result
mRNA-Gaussia Luciferase	100	10	1	100	109,100
Negative	N/A	N/A	1	100	173

Storage & Logistic
Storage Conditions: 2°C to 8°C, protect from light
Shipping Conditions: Ambient
Expiration Date of Liquid Product: 12 Months
Retest Date of Powder Product: 18 Months