mRNA-GH

Cat.#	Gene	Scale	State
LS-RMFac-004	mRNA-GH	1mg	Lyophilized/Liquid

Cat.# Gene Scale State

LS-RMFac-004 mRNA-GH 1mg Lyophilized/Liquid
Product Overview

mRNA-GH (Growth Hormone, GH) is a ready-to-use mRNA product encoding growth hormone (GH). It is suitable for research on growth and development, metabolic regulation, and regenerative medicine. GH is a key hormone involved in regulating growth and metabolic balance, with important research value in conditions such as childhood growth disorders, metabolic dysregulation, and tissue repair.

Product Details

Storage Buffer: ddH₂O ph=7.0

mRNA length: 951 nt

Amino acid sequence size: 217 aa

Handling and Storage: store at - 80 ℃ for long term
Amino acid sequence

MATGSRTSLLLAFGLLCLPWLQEGSAFPTIPLSRLFDNAMLRAHRLHQLAFDTYQEFEEAYIPKEQKYSFLQNPQTSLCFSESIPTPSNREETQQKSNLELLRISLLLIQSWLEPVQFLRSVFANSLVYGASDSNVYDLLKDLEEGIQTLMGRLEDGSPRTGQIFKQTYSKFDTNSHNDDALLKNYGLLYCFRKDMDKVETFLRIVQCRSVEGSCGF
Storage & Logistic

Storage Conditions: 2°C to 8°C, protect from light

Shipping Conditions: Ambient

Expiration Date of Liquid Product: 12 Months

Retest Date of Powder Product: 18 Months