mRNA-FLT3L

Cat.#	Gene	Scale	State
LS-RMFac-008	mRNA-FLT3L	1mg	Lyophilized/Liquid

Cat.# Gene Scale State

LS-RMFac-008 mRNA-FLT3L 1mg Lyophilized/Liquid
Product Overview

mRNA-FLT3L (Fms-like Tyrosine Kinase 3 Ligand) is a ready-to-use mRNA product encoding FLT3 ligand (FLT3L). It is suitable for research on dendritic cell (DC) expansion, hematopoietic stem cell biology, and cancer immunotherapy. FLT3L is a hematopoietic growth factor that plays a key role in the proliferation of dendritic cells and the maintenance of hematopoietic stem cells. It is widely used in cancer immunotherapy and the development of DC-based vaccines.

Product Details

Storage Buffer: ddH₂O ph=7.0

mRNA length: 834 nt

Amino acid sequence size: 178 aa

Handling and Storage: store at - 80 ℃ for long term
Amino acid sequence

MTVLAPAWSPTTYLLLLLLLSSGLSGTQDCSFQHSPISSDFAVKIRELSDYLLQDYPVTVASNLQDEELCGGLWRLVLAQRWMERLKTVAGSKMQGLLERVNTEIHFVTKCAFQPPPSCLRFVQTNISRLLQETSEQLVALKPWITRQNFSRCLELQCQPVETVFHRVSQDGLDLLTS
Storage & Logistic

Storage Conditions: 2°C to 8°C, protect from light

Shipping Conditions: Ambient

Expiration Date of Liquid Product: 12 Months

Retest Date of Powder Product: 18 Months