mRNA-FGF23

Cat.#	Gene	Scale	State
LS-RMAbt-112	mRNA-FGF23	1mg	Lyophilized/Liquid

Cat.# Gene Scale State

LS-RMAbt-112 mRNA-FGF23 1mg Lyophilized/Liquid
Product Overview

mRNA-FGF23 is an in vitro transcribed (IVT) messenger RNA encoding fibroblast growth factor 23 (FGF23), a bone-derived hormone that regulates phosphate homeostasis and vitamin D metabolism by targeting renal tubular cells. This synthetic mRNA enables controlled expression of FGF23 for research in chronic kidney disease-mineral and bone disorder (CKD-MBD), X-linked hypophosphatemia (XLH), and development of FGF23-modulating therapies for disorders of phosphate metabolism.

Product Details

Storage Buffer: ddH₂O ph=7.0

mRNA length: 1053 nt

Amino acid sequence size: 251 aa

Handling and Storage: store at – 80℃ for long term
Amino acid sequence

MLGARLRLWVCALCSVCSMSVLRAYPNASPLLGSSWGGLIHLYTATARNSYHLQIHKNGHVDGAPHQTIYSALMIRSEDAGFVVITGVMSRRYLCMDFRGNIFGSHYFDPENCRFQHQTLENGYDVYHSPQYHFLVSLGRAKRAFLPGMNPPPYSQFLSRRNEIPLIHFNT PIPRRHTRSAEDDSERDPLNVLKPRARMTPAPASCSQELPSAEDNSPMASDPLGVV RGGRVNTHAGGTGPEGCRPFAKFI
Storage & Logistic

Storage Conditions: 2°C to 8°C, protect from light

Shipping Conditions: Ambient

Expiration Date of Liquid Product: 12 Months

Retest Date of Powder Product: 18 Months