mRNA-F3

Cat.#	Gene	Scale	State
LS-RMAbt-075	mRNA—F3（CD142）	1mg	Lyophilized/Liquid

Cat.# Gene Scale State

LS-RMAbt-075 mRNA—F3（CD142） 1mg Lyophilized/Liquid
Product Overview

mRNA-F3 (CD142) is an in vitro transcribed (IVT) messenger RNA encoding the Tissue Factor (F3/CD142) protein, a transmembrane glycoprotein that serves as the primary initiator of the extrinsic coagulation cascade. This synthetic mRNA enables controlled expression of Tissue Factor for research in thrombosis mechanisms, cancer-associated coagulopathy studies, tumor microenvironment modulation, and development of targeted pro-coagulant therapies.

Product Details

Storage Buffer: ddH₂O ph=7.0

mRNA length: 1149 nt

Amino acid sequence size: 283 aa

Handling and Storage: store at - 80 ℃ for long term
Amino acid sequence

MEAPAQLLFLLLLWLPDTTGSGTTNTVAAYNLTWKSTNFKTILEWEPKPVNQVYTVQISTKSGDWKSKCFYTTDTECDLTDEIVKDVKQTYLARVFSYPAGNVESTGSAGEPLYENSPEFTPYLETNLGQPTIQSFEQVGTKVNVTVEDERTLVRRNNTFLSLRDVFGKDLIYTLYYWKSSSSGKKTAKTNTNEFLIDVDKGENYCFSVQAVIPSRTVNRKSTDSPVECMGQEKGEFREIFYIIGAVVFVVIILVIILAISLHKCRKAGVGQSWKENSPLNVS
Storage & Logistic

Storage Conditions: 2°C to 8°C, protect from light

Shipping Conditions: Ambient

Expiration Date of Liquid Product: 12 Months

Retest Date of Powder Product: 18 Months