mRNA-EPCAM

Cat.#	Gene	Scale	State
LS-RMAbt-030	mRNA-EPCAM	1mg	Lyophilized/Liquid

Cat.# Gene Scale State

LS-RMAbt-030 mRNA-EPCAM 1mg Lyophilized/Liquid
Product Overview

mRNA-EPCAM (Epithelial Cell Adhesion Molecule) is a ready-to-use mRNA product encoding the EPCAM protein. It is suitable for tumor research, cancer stem cell studies, and mRNA delivery research. EPCAM is an important biomarker for epithelial-derived cancers and is overexpressed in colorectal cancer, liver cancer, and pancreatic cancer. It is widely used in cancer diagnostics, cell sorting, and the development of antibody-based therapeutics.

Product Details

Storage Buffer: ddH₂O ph=7.0

mRNA length: 1242 nt

Amino acid sequence size: 314 aa

Handling and Storage: store at - 80 ℃ for long term
Amino acid sequence

MAPPQVLAFGLLLAAATATFAAAQEECVCENYKLAVNCFVNNNRQCQCTSVGAQNTVICSKLAAKCLVMKAEMNGSKLGRRAKPEGALQNNDGLYDPDCDESGLFKAKQCNGTSMCWCVNTAGVRRTDKDTEITCSERVRTYWIIIELKHKAREKPYDSKSLRTALQKEITTRYQLDPKFITSILYENNVITIDLVQNSSQKTQNDVDIADVAYYFEKDVKGESLFHSKKMDLTVNGEQLDLDPGQTLIYYVDEKAPEFSMQGLKAGVIAVIVVVVIAVVAGIVVLVISRKKRMAKYEKAEIKEMGEMHRELNA
Storage & Logistic

Storage Conditions: 2°C to 8°C, protect from light

Shipping Conditions: Ambient

Expiration Date of Liquid Product: 12 Months

Retest Date of Powder Product: 18 Months