mRNA-EGFP

Cat.#	Gene	Scale	State
LS-RM032	mRNA-EGFP	1mg	Lyophilized/Liquid

Cat.# Gene Scale State

LS-RM032 mRNA-EGFP 1mg Lyophilized/Liquid
Product Overview

mRNA-eGFP is a ready-to-use mRNA product encoding enhanced green fluorescent protein (eGFP). This mRNA is engineered with an optimized 5' cap structure (Cap 1), untranslated regions (UTRs), and a segmented poly(A) tail to ensure efficient translation and stable expression. It is suitable for in vitro experiments and transfection in mammalian cells.

Product Details

Storage Buffer: ddH₂O ph=7.0

mRNA length: 1017 nt

Amino acid sequence size: 239 aa

Handling and Storage: store at - 80 ℃ for long term
Amino acid sequence

MVSKGEELFTGVVPILVELDGDVNGHKFSVSGEGEGDATYGKLTLKFICTTGKLPVPWPTLVTTLTYGVQCFSRYPDHMKQHDFFKSAMPEGYVQERTIFFKDDGNYKTRAEVKFEGDTLVNRIELKGIDFKEDGNILGHKLEYNYNSHNVYIMADKQKNGIKVNFKIRHNIEDGSVQLADHYQQNTPIGDGPVLLPDNHYLSTQSALSKDPNEKRDHMVLLEFVTAAGITLGMDELYK
Cell Expression Result

Cell Line: 293T

Culture Plate: 96-well plate

Cell Confluency: 80%

Transfection Dose: 200 ng per well
Storage & Logistic

Storage Conditions: 2°C to 8°C, protect from light

Shipping Conditions: Ambient

Expiration Date of Liquid Product: 12 Months

Retest Date of Powder Product: 18 Months