mRNA-Cyno CD3E

Cat.#	Gene	Scale	State
LS-RMAbt-149	mRNA-Cyno CD3E	1mg	Lyophilized/Liquid

Cat.# Gene Scale State

LS-RMAbt-149 mRNA-Cyno CD3E 1mg Lyophilized/Liquid
Product Overview

An in vitro transcribed (IVT) messenger RNA encoding the Cynomolgus monkey (Cyno) CD3 epsilon chain (CD3E), a critical component of the T cell receptor (TCR) complex. This synthetic mRNA enables controlled expression of Cyno CD3E for research in non-human primate (NHP) immunology, developing species-specific CAR-T cell therapies, and toxicology studies for T-cell engagers.

Concentration: 1mg/mL

Storage Buffer: ddH₂O ph=7.0

mRNA length: 894 nt

Amino acid sequence size: 198 da

Handling and Storage: store at – 80℃ for long term
Amino acid sequence

MQSGTRWRVLGLCLLSIGVWGQDGNEEMGSITQTPYQVSISGTTVILTCSQHLGSEAQWQHNGKNKEDSGDRLFLPEFSEMEQSGYYVCYPRGSNPEDASHHLYLKARVCENCMEMDVMAVATIVIVDICITLGLLLLVYYWSKNRKAKAKPVTRGAGAGGRQRGQNKERPPPVPNPDYEPIRKGQQDLYSGLNQRRI
Storage & Logistic

Storage Conditions: 2°C to 8°C, protect from light

Shipping Conditions: Ambient

Expiration Date of Liquid Product: 12 Months

Retest Date of Powder Product: 18 Months