mRNA-Cyno BCMA

Cat.#	Gene	Scale	State
LS-RMAbt-181	mRNA-Cyno BCMA	1mg	Lyophilized/Liquid

Cat.# Gene Scale State

LS-RMAbt-181 mRNA-Cyno BCMA 1mg Lyophilized/Liquid
Product Overview

An off-the-shelf in vitro transcribed (IVT) messenger RNA encoding the Cynomolgus monkey BCMA (TNFRSF17), a tumor necrosis factor receptor family member selectively expressed on plasma cells and a primary target in multiple myeloma. This synthetic mRNA enables controlled expression of BCMA for research in plasma cell biology, antibody production mechanisms, and the development of BCMA-targeted CAR-T or bispecific antibody therapies for hematologic cancers.

Product Details

Storage Buffer: ddH₂O ph=7.0

mRNA length: 849 nt

Amino acid sequence size: 183 aa

Handling and Storage: store at - 80 ℃ for long term
Amino acid sequence

MLQMARQCSQNEYFDSLLHDCKPCQLRCSSTPPLTCQRYCNASMTNSVKGMNAILWTCLGLSLIISLAVFVLTFLLRKMSSEPLKDEFKNTGSGLLGMANIDLEKGRTGDEIVLPRGLEYTVEECTCEDCIKNKPKVDSDHCFPLPAMEEGATILVTTKTNDYCNSLSAALSVTEIEKSISAR*
Storage & Logistic

Storage Conditions: 2°C to 8°C, protect from light

Shipping Conditions: Ambient

Expiration Date of Liquid Product: 12 Months

Retest Date of Powder Product: 18 Months