mRNA-CSF3

Cat.#	Gene	Scale	State
LS-RMFac-016	mRNA-CSF3	1mg	Lyophilized/Liquid

Cat.# Gene Scale State

LS-RMFac-016 mRNA-CSF3 1mg Lyophilized/Liquid
Product Overview

mRNA-CSF3 (Colony Stimulating Factor 3, G-CSF) is a ready-to-use mRNA product encoding granulocyte colony-stimulating factor (G-CSF). It is suitable for research on neutrophil function, inflammation regulation, and bone marrow proliferation. G-CSF is a key factor that promotes the production and mobilization of neutrophils and is widely used in applications related to bone marrow transplantation, infection defense, and regenerative medicine.

Product Details

Storage Buffer: ddH₂O ph=7.0

mRNA length: 921 nt

Amino acid sequence size: 207 aa

Handling and Storage: store at - 80 ℃ for long term
Amino acid sequence

MAGPATQSPMKLMALQLLLWHSALWTVQEATPLGPASSLPQSFLLKCLEQVRKIQGDGAALQEKLVSECATYKLCHPEELVLLGHSLGIPWAPLSSCPSQALQLAGCLSQLHSGLFLYQGLLQALEGISPELGPTLDTLQLDVADFATTIWQQMEELGMAPALQPTQGAMPA FASAFQRRAGGVLVASHLQSFLEVSYRVLRHLAQP
Storage & Logistic

Storage Conditions: 2°C to 8°C, protect from light

Shipping Conditions: Ambient

Expiration Date of Liquid Product: 12 Months

Retest Date of Powder Product: 18 Months