mRNA-CSF2

Cat.#	Gene	Scale	State
LS-RMFac-015	mRNA-CSF2	1mg	Lyophilized/Liquid

Cat.# Gene Scale State

LS-RMFac-015 mRNA-CSF2 1mg Lyophilized/Liquid
Product Overview

mRNA-CSF2 (Colony Stimulating Factor 2, GM-CSF) is a ready-to-use mRNA product encoding granulocyte-macrophage colony-stimulating factor (GM-CSF). It is suitable for research on dendritic cell proliferation, anti-tumor immunity, and tissue regeneration. GM-CSF plays a crucial role in the expansion of dendritic cells and is widely used in cancer vaccine development, making it an important tool in cancer immunotherapy and regenerative medicine research.

Product Details

Storage Buffer: ddH₂O ph=7.0

mRNA length: 732 nt

Amino acid sequence size: 144 aa

Handling and Storage: store at - 80 ℃ for long term
Amino acid sequence

MWLQSLLLLGTVACSISAPARSPSPSTQPWEHVNAIQEARRLLNLSRDTAAEMNETVEVISEMFDLQEPTCLQTRLELYKQGLRGSLTKLKGPLTMMASHYKQHCPPTPETSCATQIITFESFKENLKDFLLVIPFDCWEPVQE
Storage & Logistic

Storage Conditions: 2°C to 8°C, protect from light

Shipping Conditions: Ambient

Expiration Date of Liquid Product: 12 Months

Retest Date of Powder Product: 18 Months