mRNA-CLEC12A

Cat.#	Gene	Scale	State
LS-RMAbt-129	mRNA-CLEC12A	1mg	Lyophilized/Liquid

Cat.# Gene Scale State

LS-RMAbt-129 mRNA-CLEC12A 1mg Lyophilized/Liquid
Product Overview

mRNA-CLEC12A is an in vitro transcribed (IVT) messenger RNA encoding the C-type lectin domain family 12 member A (CLEC12A, also known as MICL or CLL-1), an inhibitory receptor expressed on myeloid cells that recognizes endogenous danger signals and modulates immune responses through SYK kinase signaling. This synthetic mRNA enables controlled expression of CLEC12A for research in acute myeloid leukemia (AML) biology, dendritic cell tolerance mechanisms, and development of CLEC12A-targeted immunotherapies (e.g., CAR-T cells or antibody-drug conjugates) for myeloid malignancies.

Product Details

Storage Buffer: ddH₂O ph=7.0

mRNA length: 1095 nt

Amino acid sequence size: 265 aa

Handling and Storage: store at – 80℃ for long term
Amino acid sequence

MSEEVTYADLQFQNSSEMEKIPEIGKFGEKAPPAPSHVWRPAALFLTLLCLLLLIGLGVLASMFHVTLKIEMKKMNKLQNISEELQRNISLQLMSNMNISNKIRNLSTTLQTIATKLCRELYSKEQEHKCKPCPRRWIWHKDSCYFLSDDVQTWQESKMACAAQNASLLKINN KNALEFIKSQSRSYDYWLGLSPEEDSTRGMRVDNIINSSAWVIRNAPDLNNMYCGYI NRLYVQYYHCTYKKRMICEKMANPVQLGSTYFREA
Storage & Logistic

Storage Conditions: 2°C to 8°C, protect from light

Shipping Conditions: Ambient

Expiration Date of Liquid Product: 12 Months

Retest Date of Powder Product: 18 Months