mRNA-CLDN6

Cat.#	Gene	Scale	State
LS-RMAbt-131	mRNA-CLDN6	1mg	Lyophilized/Liquid

Cat.# Gene Scale State

LS-RMAbt-131 mRNA-CLDN6 1mg Lyophilized/Liquid
Product Overview

mRNA-CLDN6 is an in vitro transcribed (IVT) messenger RNA encoding the claudin-6 (CLDN6), a tight junction protein normally restricted to embryonic tissues but frequently reactivated in cancers (e.g., testicular, ovarian, and lung carcinomas). This synthetic mRNA enables controlled expression of CLDN6 for research in tumor microenvironment studies, epithelial barrier function, and development of CLDN6-directed immunotherapies (e.g., CAR-T cells or antibody-drug conjugates) targeting CLDN6-positive malignancies.

Product Details

Storage Buffer: ddH₂O ph=7.0

mRNA length: 960 nt

Amino acid sequence size: 220 aa

Handling and Storage: store at – 80℃ for long term
Amino acid sequence

MASAGMQILGVVLTLLGWVNGLVSCALPMWKVTAFIGNSIVVAQVVWEGLWMSCVVQSTGQMQCKVYDSLLALPQDLQAARALCVIALLVALFGLLVYLAGAKCTTCVEEKDSKARLVLTSGIVFVISGVLTLIPVCWTAHAIIRDFYNPLVAEAQKRELGASLYLGWAASG LLLLGGGLLCCTCPSGGSQGPSHYMARYSTSAPAISRGPSEYPTKNYV
Storage & Logistic

Storage Conditions: 2°C to 8°C, protect from light

Shipping Conditions: Ambient

Expiration Date of Liquid Product: 12 Months

Retest Date of Powder Product: 18 Months