mRNA-CD9

Cat.#	Gene	Scale	State
LS-RMAbt-069	mRNA-CD9	1mg	Lyophilized/Liquid

Cat.# Gene Scale State

LS-RMAbt-069 mRNA-CD9 1mg Lyophilized/Liquid
Product Overview

mRNA-CD9 is an in vitro transcribed (IVT) messenger RNA encoding the CD9 protein, a member of the tetraspanin family that regulates cell adhesion, migration, and signal transduction. This synthetic mRNA enables controlled expression of CD9 for research in cancer biology, stem cell studies, and immune regulation, particularly in the context of exosome biogenesis and cell-cell communication.

Product Details

Storage Buffer: ddH₂O ph=7.0

mRNA length: 984 nt

Amino acid sequence size: 228 aa

Handling and Storage: store at – 80℃ for long term
Amino acid sequence

MPVKGGTKCIKYLLFGFNFIFWLAGIAVLAIGLWLRFDSQTKSIFEQETNNNNSSFYTGVYILIGAGALMMLVGFLGCCGAVQESQCMLGLFFGFLLVIFAIEIAAAIWGYSHKDEVIKEVQEFYKDTYNKLKTKDEPQRETLKAIHYALNCCGLAGGVEQFISDICPKKDVLETFTVKSCPDAIKEVFDNKFHIIGAVGIGIAVVMIFGMIFSMILCCAIRRNREMV
Storage & Logistic

Storage Conditions: 2°C to 8°C, protect from light

Shipping Conditions: Ambient

Expiration Date of Liquid Product: 12 Months

Retest Date of Powder Product: 18 Months