mRNA-CD81

Cat.#	Gene	Scale	State
LS-RMAbt-071	mRNA-CD81	1mg	Lyophilized/Liquid

Cat.# Gene Scale State

LS-RMAbt-071 mRNA-CD81 1mg Lyophilized/Liquid
Product Overview

mRNA-CD81 is an in vitro transcribed (IVT) messenger RNA encoding the CD81 protein, a key member of the tetraspanin superfamily that serves as a crucial organizer of membrane microdomains and facilitates diverse cellular processes including cell adhesion, migration, and signal transduction. This synthetic mRNA enables precise modulation of CD81 expression for investigating viral entry mechanisms (particularly hepatitis C virus infection), immune synapse formation in lymphocytes, and tumor microenvironment interactions in cancer biology research.

Product Details

Storage Buffer: ddH₂O ph=7.0

mRNA length: 1008 nt

Amino acid sequence size: 236 aa

Handling and Storage: store at – 80℃ for long term
Amino acid sequence

MGVEGCTKCIKYLLFVFNFVFWLAGGVILGVALWLRHDPQTTNLLYLELGDKPAPNTFYVGIYILIAVGAVMMFVGFLGCYGAIQESQCLLGTFFTCLVILFACEVAAGIWGFVNKDQIAKDVKQFYDQALQQAVVDDDANNAKAVVKTFHETLDCCGSSTLTALTTSVLKNNLCPSGSNIISNLFKEDCHQKIDDLFSGKLYLIGIAAIVVAVIMIFEMILSMVLCCGIRNSSVY
Storage & Logistic

Storage Conditions: 2°C to 8°C, protect from light

Shipping Conditions: Ambient

Expiration Date of Liquid Product: 12 Months

Retest Date of Powder Product: 18 Months